DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SRSF3

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:194 Identity:96/194 - (49%)
Similarity:106/194 - (54%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTV 69
            |.|.|||||:||||..|.:||..||.||.|||||:|||||||||||||..||||||||.|||||:
Human     7 PLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTL 71

  Fly    70 CGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRG-----GGGRGDDKCYECGGRGHFARH 129
            ||.|.|||||.|: .||                  |:||     |....||         :..|.
Human    72 CGCRVRVELSNGE-KRS------------------RNRGPPPSWGRRPRDD---------YRRRS 108

  Fly   130 CRERKARQRRRSNSFSRSRSTSR-RRRTR----------SKSGTRSRSRSAGSVGRRSGRSNGR 182
            ...|:...||||.|.|||||.|| |||.|          |:|.:||||||         |||.|
Human   109 PPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRS---------RSNER 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 57/76 (75%)
RRM_SRSF3_like 9..81 CDD:240819 55/71 (77%)
SRSF3NP_003008.1 Sufficient for interaction with NXF1 1..90 61/101 (60%)
RRM_SRSF3 6..86 CDD:241089 58/79 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 40/120 (33%)
2 X approximate repeats, basic 119..164 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - otm41300
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.