DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SRSF1

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_008855.1 Gene:SRSF1 / 6426 HGNCID:10780 Length:248 Species:Homo sapiens


Alignment Length:289 Identity:95/289 - (32%)
Similarity:113/289 - (39%) Gaps:116/289 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI--ARNPPGFAFVEFESARDAADAVRGLDGRT 68
            :|.::|||:|..:.|..|:|.||..||::|.:.:  .|..|.|||||||..|||.|||.|.||..
Human    14 NDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYD 78

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGG------------------GGRGD- 114
            ..|.|.|||     :.|||.|.|.||||||||| ..|.|.|                  |...| 
Human    79 YDGYRLRVE-----FPRSGRGTGRGGGGGGGGG-APRGRYGPPSRRSENRVVVSGLPPSGSWQDL 137

  Fly   115 --------DKCYE---CGGRG-----------HFARHCRERKARQRR-------------RSNSF 144
                    |.||.   ..|.|           :..|.....|.|...             ||.|:
Human   138 KDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSY 202

  Fly   145 SRSRSTSR-RRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPP 208
            .||||.|| |.|:||:|.:||||.|                                       |
Human   203 GRSRSRSRSRSRSRSRSNSRSRSYS---------------------------------------P 228

  Fly   209 KRRYEDEDDDRVRGSPR-----SRSRSRS 232
            :|.         |||||     ||||||:
Human   229 RRS---------RGSPRYSPRHSRSRSRT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 35/73 (48%)
SRSF1NP_008855.1 RRM1_SRSF1 12..90 CDD:410010 36/80 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..134 18/46 (39%)
RRM2_SRSF1 113..196 CDD:410160 11/82 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..248 31/104 (30%)
Interaction with SAFB1 198..247 30/96 (31%)

Return to query results.
Submit another query.