DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and RBM3

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_006734.1 Gene:RBM3 / 5935 HGNCID:9900 Length:157 Species:Homo sapiens


Alignment Length:184 Identity:53/184 - (28%)
Similarity:78/184 - (42%) Gaps:46/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAADAVRGLDGRT 68
            |::||.|..|..:..||..|.::|.:..|.:.::     ..||.|:.|.:...|:.|:|.::|.:
Human     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGES 71

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGG--GRGDDKCYEC--GGRGHFARH 129
            :.||:.||: ..||.||...|||.|..|.|    ....||||  |.|..:.|:.  ||.|:    
Human    72 LDGRQIRVD-HAGKSARGTRGGGFGAHGRG----RSYSRGGGDQGYGSGRYYDSRPGGYGY---- 127

  Fly   130 CRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRD 183
                         .:.|||..:              .|:.|...|.|| .|.||
Human   128 -------------GYGRSRDYN--------------GRNQGGYDRYSG-GNYRD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 22/76 (29%)
RBM3NP_006734.1 RRM_CIRBP_RBM3 6..85 CDD:409883 23/78 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..157 31/109 (28%)

Return to query results.
Submit another query.