DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf7b

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001025438.1 Gene:srsf7b / 572211 ZFINID:ZDB-GENE-050913-95 Length:178 Species:Danio rerio


Alignment Length:158 Identity:76/158 - (48%)
Similarity:86/158 - (54%) Gaps:37/158 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGR 67
            ||..:.|||||:||..|.|.:||..||.||.||||||||||.||||||||..|||.|:||||||:
Zfish     6 RHGGETKVYVGNLGTGAGKGELERAFGYYGPLRSVWIARNPAGFAFVEFEDPRDAEDSVRGLDGK 70

  Fly    68 TVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGR---GDDKCYECGGRGHFARH 129
            .:||.|.|||||||...||                 ..|.....|   .:|:|||||.:||:|..
Zfish    71 VICGSRVRVELSTGMPRRS-----------------RYDHPPSRRPFDPNDRCYECGEKGHYAYD 118

  Fly   130 CRERKARQRRRSNSFSRSRSTSRRRRTR 157
            |..                 .|||||||
Zfish   119 CHR-----------------YSRRRRTR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 54/78 (69%)
RRM_SRSF3_like 9..81 CDD:240819 51/71 (72%)
srsf7bNP_001025438.1 RRM <10..>83 CDD:223796 50/72 (69%)
RRM_SRSF7 12..88 CDD:241090 53/75 (71%)
ZnF_C2HC 105..119 CDD:197667 8/13 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - otm25438
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.