DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and rbm4.2

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_955971.1 Gene:rbm4.2 / 557528 ZFINID:ZDB-GENE-030131-3019 Length:385 Species:Danio rerio


Alignment Length:302 Identity:68/302 - (22%)
Similarity:103/302 - (34%) Gaps:78/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            |::|.::.:.....:|...|..||.:....|.::   :|||..|...||.:|:.||:..|..|:.
Zfish    79 KLHVSNISSGCTNQELRAKFEEYGPVVECDIVKD---YAFVHMERMDDAMEAISGLENTTFQGKL 140

  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRERKARQR 138
            .:|:|||.:...:.|.|               |:.|       ||.||.:||:::.||..:....
Zfish   141 IKVQLSTSRLRTAPGMG---------------DQTG-------CYICGEQGHWSKDCRHSQNGSY 183

  Fly   139 RRSNSFSRSRSTSRRRRTRSKSG------------------TRSRSRSAGSVGRR-SGRSNGRDE 184
            ........||...|...:....|                  ..||..|.|..|.. ..|...|..
Zfish   184 GGGMGGYPSRGPPRGGPSYGMGGPGGHPSRGYPAGPLPPPPPMSRRPSYGEYGAEPRERYLTRVP 248

  Fly   185 NGSASRYSDHERNGSGAVD----------------------SPPPPKRRYEDEDDDRVRGSPRSR 227
            .|...|...:||:..|::|                      .||||..........|:|.:|.|.
Zfish   249 TGYPERPPVYERDRFGSIDYYEKFRAHPAASSYYEDRPHAIPPPPPPPPLSSSSLSRMRLAPPSL 313

  Fly   228 S------------RSRSASPAVRRGSPPRRRGDSSASRSVSR 257
            .            .:.:|:...|..||.||.|..:...|..|
Zfish   314 DPYERRPLAPPPPTAAAAASFARDRSPIRRVGAGAEGYSYER 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 22/72 (31%)
RRM_SRSF3_like 9..81 CDD:240819 21/71 (30%)
rbm4.2NP_955971.1 RRM1_2_CoAA_like 3..68 CDD:240789
RRM_SF 78..144 CDD:302621 18/67 (27%)
ZnF_C2HC 161..177 CDD:197667 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.