DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SC35

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:236 Identity:77/236 - (32%)
Similarity:92/236 - (38%) Gaps:82/236 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGDLGNNARKNDLEYVFGAYGSLRSVWI-----ARNPPGFAFVEFESARDAADAVRGLDGRTVCG 71
            |.:|.......||..||...|.:..::|     .|...|||||.|...|||.||:..:|||.:.|
  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91

  Fly    72 RRARVELSTGKY------ARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC 130
            |..||:::  :|      .||..|..|||||||.||                             
  Fly    92 RELRVQMA--RYGRPSSPTRSSSGRRGGGGGGGSGG----------------------------- 125

  Fly   131 RERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRS--GRS--NGRDENGSASRY 191
                 |:|.||.|..|.||.|.|||:.|    ||||..:.|..|||  .||  .|...||..|  
  Fly   126 -----RRRSRSRSPMRRRSRSPRRRSYS----RSRSPGSHSPERRSKFSRSPVRGDSRNGIGS-- 179

  Fly   192 SDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRS 232
                  |||.:                   ....|||||||
  Fly   180 ------GSGGL-------------------APAASRSRSRS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 27/74 (36%)
RRM_SRSF3_like 9..81 CDD:240819 27/73 (37%)
SC35NP_001188794.1 RRM <24..>100 CDD:223796 27/74 (36%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.