DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SF2

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster


Alignment Length:300 Identity:89/300 - (29%)
Similarity:106/300 - (35%) Gaps:106/300 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWI--ARNPPGFAFVEFESARDAADAVRGLDGRTVCG 71
            ::|||:|..:.|..|::.:|..:|.:..|.:  .|.|| |||||||.||||.|||:..||....|
  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPP-FAFVEFEDARDADDAVKARDGYDYDG 71

  Fly    72 RRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG------------ 124
            .|.|||...          |||.|...||....|.|.||||       .||||            
  Fly    72 YRLRVEFPR----------GGGPGSYRGGNRNDRSRDGGGR-------MGGRGPPAKRSQYRVMV 119

  Fly   125 -----------------------------------HFARHCRERKARQRRRSNSFSRSRSTSRRR 154
                                               .|.||...:.|.::...:.|..........
  Fly   120 TGLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYI 184

  Fly   155 RTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDR 219
            |.|..||...|....|..|...|.|.|               .||          |.|.|     
  Fly   185 RVREDSGDNDRGGGGGGSGGGGGGSGG---------------GGS----------RDYRD----- 219

  Fly   220 VRGSPRSRSRSRSASPAVRRGSP---PRRRGDSSASRSVS 256
                 ||||||.|:.|. |||:|   |.||...|.|||.|
  Fly   220 -----RSRSRSFSSRPR-RRGTPTYSPVRRQSYSRSRSRS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 33/74 (45%)
RRM_SRSF3_like 9..81 CDD:240819 33/73 (45%)
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/72 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 6/72 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.