DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf10

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001011096.1 Gene:srsf10 / 496509 XenbaseID:XB-GENE-492982 Length:258 Species:Xenopus tropicalis


Alignment Length:284 Identity:84/284 - (29%)
Similarity:120/284 - (42%) Gaps:85/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRH--PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI-----ARNPPGFAFVEFESARDAA 58
            |||:  |.:..::|.::.::.|..||...||.||.:..|::     .|.|.|||:|:||..|||.
 Frog     1 MSRYLRPPNTSLFVRNIADDIRSEDLRREFGRYGPIVDVYVPLDYYTRRPRGFAYVQFEDVRDAE 65

  Fly    59 DAVRGLDGRTVCGRRARVELSTG-------KYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDK 116
            ||:..||.:.:|||:..::.:.|       ..|:.                 ||...|..|.||.
 Frog    66 DALHNLDKKWICGRQIEIQFAQGDRKTPNQMKAKE-----------------GRSTYGSSRYDDD 113

  Fly   117 CYECGGRGHFARHCRERKAR--QRRRSNSFS--------------------RSRSTS------RR 153
                       ||.|..::|  :||||.|.|                    ||||.|      |.
 Frog   114 -----------RHNRRSRSRSYERRRSRSRSFEQNYGRSYSPRGRGGERLHRSRSRSDHGRFNRH 167

  Fly   154 RRTRSKSGTRSRSRSAGSVGR-----RSG---RSNGRDENGSASRYSDHERNGSGAVDSPPPPKR 210
            .|:||:||:.|||||.....:     |||   .|.|..:..|.||..::.|....:       :|
 Frog   168 NRSRSRSGSNSRSRSKSEPKKTVREQRSGSRSHSRGHSKADSKSRCRENSRYNRES-------RR 225

  Fly   211 RYEDEDDDRVRGSPRSRSRSRSAS 234
            ...::.....|...||||:|||.|
 Frog   226 DEHEQSKSPSRSVSRSRSKSRSRS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 32/94 (34%)
RRM_SRSF3_like 9..81 CDD:240819 27/76 (36%)
srsf10NP_001011096.1 RRM_SF 10..93 CDD:388407 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.