DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf12

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001007946.1 Gene:srsf12 / 493321 XenbaseID:XB-GENE-994981 Length:253 Species:Xenopus tropicalis


Alignment Length:79 Identity:24/79 - (30%)
Similarity:31/79 - (39%) Gaps:26/79 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 CCEW-------NLPSLVRLTLSRNEL----------SRLPTCLSL---VMPNVTYLLLDSNALTD 271
            ||.|       :.|:....|:||.:|          |.|| |.||   .:|.||  ...|..|..
 Frog   443 CCCWAPRSDLKDRPARDGATVSRMKLQVWGTLTSLGSTLP-CRSLSSHKLPWVT--ASSSRPLPA 504

  Fly   272 GDSW---YSILTLE 282
            |...   :.||:||
 Frog   505 GPLMTPSHPILSLE 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808
srsf12NP_001007946.1 RRM_SF 6..99 CDD:473069
U2AF_lg 129..>218 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.