DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf7

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001007487.1 Gene:srsf7 / 493215 XenbaseID:XB-GENE-920026 Length:234 Species:Xenopus tropicalis


Alignment Length:270 Identity:119/270 - (44%)
Similarity:143/270 - (52%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGR 67
            |:..:.|||||:||..|.|.:||..|..||.||:||||||||||||||||..|||.||||||||:
 Frog     6 RYAGEAKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDTRDAEDAVRGLDGK 70

  Fly    68 TVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGR---GDDKCYECGGRGHFA-- 127
            .:||.|.|||||||...||                 ..||....|   ..|:|||||.:||:|  
 Frog    71 VICGSRVRVELSTGMPRRS-----------------RYDRPPARRPFDPSDRCYECGEKGHYAYD 118

  Fly   128 --RHCRERKARQRRRSNS------FSRSRSTSRRRRTRSKSGTRSRS---RSAGSVGRRSGRSNG 181
              |:.|.|::|.|.||:|      ::||||.||.||:||.|..||||   |.:.:...||.||..
 Frog   119 CQRYSRRRRSRTRSRSHSRSRGRRYTRSRSRSRGRRSRSASPRRSRSASPRRSRNATPRSSRSGS 183

  Fly   182 RDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRR 246
            ...:.|.||.....|:.|                       .|||||:||||||  :|...|.| 
 Frog   184 VKRSRSLSRSRSRSRSVS-----------------------RPRSRSKSRSASP--KRSRSPSR- 222

  Fly   247 GDSSASRSVS 256
               |..||:|
 Frog   223 ---SPQRSIS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 53/78 (68%)
RRM_SRSF3_like 9..81 CDD:240819 51/71 (72%)
srsf7NP_001007487.1 RRM_SF 12..88 CDD:327398 53/75 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I3963
OMA 1 1.010 - - QHG46644
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - otm48506
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.