DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Rbm4b

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001007015.2 Gene:Rbm4b / 474154 RGDID:1359343 Length:357 Species:Rattus norvegicus


Alignment Length:268 Identity:64/268 - (23%)
Similarity:98/268 - (36%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDG 66
            ::..:..|::||::.......:|...|..||.:....|.::   :|||..|.|.||.:|:||||.
  Rat    72 NKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKD---YAFVHMERAEDAVEAIRGLDN 133

  Fly    67 RTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCR 131
            ....|:|..|:|||.:...:.|.|               |:.|       ||.||..||:::.|.
  Rat   134 TEFQGKRMHVQLSTSRLRTAPGMG---------------DQSG-------CYRCGKEGHWSKECP 176

  Fly   132 -ERKARQRRRSNSFSRSRSTSRRRRTRSKSGT--------------RSRSRSAGSVGRRSGRSNG 181
             :|..|....:..::......|...|.....:              |.|.||..:|...:.    
  Rat   177 VDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMYYNDAYGALDYYKRYRVRSYEAVAAAAA---- 237

  Fly   182 RDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRG-SPRSRSRSRSASPAV-------- 237
                .||..|::...:....|.|...|........|...|. ...|.|.:.||:.|.        
  Rat   238 ----ASAYNYAEQTMSHLPQVQSSAVPSHLNSTSVDPYDRHLLQNSGSAATSAAMAAAASSSYYG 298

  Fly   238 RRGSPPRR 245
            |..||.||
  Rat   299 RDRSPLRR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 26/79 (33%)
RRM_SRSF3_like 9..81 CDD:240819 25/71 (35%)
Rbm4bNP_001007015.2 RRM1_RBM4 2..68 CDD:241050
RRM2_RBM4 78..144 CDD:241051 22/68 (32%)
ZnF_C2HC 161..176 CDD:197667 7/21 (33%)
Interaction with TNPO3. /evidence=ECO:0000250 196..357 25/119 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.