DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf3

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_012815513.1 Gene:srsf3 / 448605 XenbaseID:XB-GENE-490817 Length:183 Species:Xenopus tropicalis


Alignment Length:190 Identity:91/190 - (47%)
Similarity:102/190 - (53%) Gaps:45/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTV 69
            |.|.|||||:||||..|.:||..||.||.|||||:|||||||||||||..||||||||.|||||:
 Frog    26 PLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTL 90

  Fly    70 CGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC-RER 133
            ||.|.|||||.|                        ::....||....:....|..:.|.. ..|
 Frog    91 CGCRVRVELSNG------------------------EKRSRNRGPPPSWNRRPRDDYRRRSPPPR 131

  Fly   134 KARQRRRSNSFSRSRSTSR-RRRTR----------SKSGTRSRSRSAGSVGRRSGRSNGR 182
            :...||||.|.|||||.|| |||.|          |:|.:||||||         |||.|
 Frog   132 RRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRS---------RSNER 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 57/76 (75%)
RRM_SRSF3_like 9..81 CDD:240819 55/71 (77%)
srsf3XP_012815513.1 RRM <11..>112 CDD:223796 60/109 (55%)
RRM_SF 25..105 CDD:302621 58/102 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6596
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - otm48506
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.