DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and B52

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:360 Identity:102/360 - (28%)
Similarity:131/360 - (36%) Gaps:144/360 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :||||.|....|:.|||..|..||..|.:.|..   |:.|||||..|||.|||..|:|:.:.|.|
  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGER 66

  Fly    74 ARVELSTG------------KYARSGGGGGG---------------------------------- 92
            ..||.:.|            :|....|||||                                  
  Fly    67 VVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRV 131

  Fly    93 --------------------------------------------------------------GGG 95
                                                                          ||.
  Fly   132 SWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGR 196

  Fly    96 GGGGGGLG-GRDRGGGGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRSTSRRR--RTR 157
            .|||||.| ||.|....|              :|....|::|.||.|:|.|:|||.|:.|  |::
  Fly   197 SGGGGGSGRGRSRSSSSR--------------SRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSK 247

  Fly   158 SKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRG 222
            |||..:|||||      ||..:..||.:.|.|:  .|.|..|.:      |||  |.:...|.|.
  Fly   248 SKSPVKSRSRS------RSRSNKSRDVSKSKSK--SHSRTRSRS------PKR--ERDSRSRSRS 296

  Fly   223 SPRSRSRSRSASPAVRRGSPPRRRGDSSASRSVSR 257
            ..:..|||||.|.::.|.|..|.|..|:.::|.||
  Fly   297 VSKRESRSRSRSKSIHRDSRSRDRSASAENKSRSR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 33/84 (39%)
RRM_SRSF3_like 9..81 CDD:240819 32/71 (45%)
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 32/71 (45%)
RRM2_SRSF4_like 120..191 CDD:241044 0/70 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.