DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and rump

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster


Alignment Length:203 Identity:59/203 - (29%)
Similarity:81/203 - (39%) Gaps:58/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRHPSDRKVYVGDLGNNARKNDLEYVF-GAYGSLRSVWIARNPPGFA----FVEFESARDAADAV 61
            ||...:.:||:.::..:.|..||:.:| ...||:..|.:..:..|.|    .|||:...:...|:
  Fly    51 SRERRNCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKAL 115

  Fly    62 RGLDGRTVCGRRARVELSTG----KYAR--SGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYEC 120
            ..::...|.||...|:...|    :|.|  ..||||||||||..||.||.:.||||         
  Fly   116 EKMNRYEVNGRELVVKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGG--------- 171

  Fly   121 GGRGHFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSN----G 181
            |||.|..                 .|.|..|||                 ...|.|||:|    .
  Fly   172 GGRDHMD-----------------DRDRGFSRR-----------------DDDRLSGRNNFNMMS 202

  Fly   182 RDENGSAS 189
            .|.|.|::
  Fly   203 NDYNNSSN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 19/76 (25%)
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 59/203 (29%)
RRM1_hnRNPM_like 58..133 CDD:409819 19/74 (26%)
RRM2_hnRNPM_like 234..307 CDD:409820
RRM_SF 565..629 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.