DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf9

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001299828.1 Gene:srsf9 / 405835 ZFINID:ZDB-GENE-040426-2397 Length:245 Species:Danio rerio


Alignment Length:279 Identity:89/279 - (31%)
Similarity:110/279 - (39%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN----PPGFAFVEFESARDAADAVRGLDG 66
            ||.::|||:|..:.::.|:|.:|..||.:|.:.:..|    |  ||||.||..|||.|||.|.:|
Zfish     2 SDGRIYVGNLPMDVQERDIEDLFFKYGKIRDIELKNNRSTIP--FAFVRFEDPRDAEDAVFGRNG 64

  Fly    67 RTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGG------------------GGRG 113
            ......:.|||     |.||.|....|..|||||| |.|.|.|                  |...
Zfish    65 YGFGDCKLRVE-----YPRSSGSKFSGPAGGGGGG-GPRGRFGPPTRRSEFRVIVTGLPPTGSWQ 123

  Fly   114 D---------DKCY---ECGGRG--HFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGT-- 162
            |         |.|:   :..|.|  .|.|......|.:|..|..|...:..:...|...:.||  
Zfish   124 DLKDHMREAGDVCFADVQRDGEGVVEFLRREDMEYALRRLDSTEFRSHQGETAYIRVMEERGTSW 188

  Fly   163 -RSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRS 226
             ||||||         ||.||......||            .||||   ||........|.||.|
Zfish   189 GRSRSRS---------RSRGRYTPPYQSR------------GSPPP---RYRSPPRHMTRHSPPS 229

  Fly   227 RSRSRSASPAVRRGSPPRR 245
            |      .|.::..|||.|
Zfish   230 R------RPPLQHHSPPPR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 31/79 (39%)
RRM_SRSF3_like 9..81 CDD:240819 29/75 (39%)
srsf9NP_001299828.1 RRM <1..>76 CDD:223796 31/80 (39%)
RRM1_SRSF9 5..76 CDD:241042 29/77 (38%)
RRM_SF 109..184 CDD:302621 13/74 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.