DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and rbm4b

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_989204.1 Gene:rbm4b / 394812 XenbaseID:XB-GENE-494431 Length:338 Species:Xenopus tropicalis


Alignment Length:267 Identity:66/267 - (24%)
Similarity:105/267 - (39%) Gaps:58/267 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            |::|.:|..:....:|...|..||::....|.::   :|||..|.:.:|.||::.||.....|:|
 Frog    79 KLHVSNLSTSCTSEELRAKFEEYGAVLECDIVKD---YAFVHMERSAEALDAIKNLDNTEFKGKR 140

  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHC-RERKARQ 137
            ..|:|||.:...:             .|:|.|.|         ||.||..||:::.| .::..::
 Frog   141 MHVQLSTSRLRVT-------------PGMGERTR---------CYRCGKEGHWSKECPLDQMTKE 183

  Fly   138 RRRS---------NSFSRSRSTSRRRRT----RSKSGTRSRSRSAGSVGRRSGRSNGRDE----- 184
            ..::         :.:...||.:...||    |.....|.|........|...|.:..|.     
 Frog   184 LEQAPGYPPESFPDPYGPMRSAAAAYRTAYAHRVFYDERERFSIVDYYQRYRVRPSSYDALIERR 248

  Fly   185 ----NGSASRYSDHERNGSGAVDS---PPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAV----R 238
                ..:|:..|..||..|...:.   ||||:........:|   ||..||.|.|:|..:    |
 Frog   249 LTALPSAATTVSYRERIESFPYERHLLPPPPELPSSYYPRER---SPLRRSSSASSSMEIYRTER 310

  Fly   239 RGSPPRR 245
            |.||..|
 Frog   311 RLSPIMR 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 23/72 (32%)
RRM_SRSF3_like 9..81 CDD:240819 22/71 (31%)
rbm4bNP_989204.1 RRM_SF 2..68 CDD:388407
RRM_SF 78..144 CDD:388407 19/67 (28%)
ZnF_C2HC 161..176 CDD:197667 7/23 (30%)
COG5222 <162..>201 CDD:227547 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.