DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf3a

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001002053.1 Gene:srsf3a / 368925 ZFINID:ZDB-GENE-030616-631 Length:174 Species:Danio rerio


Alignment Length:180 Identity:90/180 - (50%)
Similarity:101/180 - (56%) Gaps:32/180 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTV 69
            |.|.|||||:|||:..|.:||..||.||.|||||:|||||||||||||..|||.||||.|||||:
Zfish    11 PLDCKVYVGNLGNSGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDATDAVRELDGRTL 75

  Fly    70 CGRRARVELSTG-KYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRER 133
            ||.|.|||:|.| |.:|.         .|.......|.|....||||         :..|.....
Zfish    76 CGCRVRVEMSNGEKRSRF---------RGPPPSWSRRPRDDYRRGDD---------YRRRSSPPA 122

  Fly   134 KARQRRRSNSFSRSRSTSRRRR-------------TRSKSGTRSRSRSAG 170
            :.|..|||.|.|||||.||.||             :||.||:||||||.|
Zfish   123 RHRSPRRSFSRSRSRSLSRERRRERSLSRDRNYKPSRSFSGSRSRSRSNG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 55/77 (71%)
RRM_SRSF3_like 9..81 CDD:240819 52/71 (73%)
srsf3aNP_001002053.1 RRM_SF 10..90 CDD:302621 55/78 (71%)
RRM <13..>97 CDD:223796 57/92 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.