DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and tra2

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:177 Identity:51/177 - (28%)
Similarity:74/177 - (41%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HP-SDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI-----ARNPPGFAFVEFESARDAADAVR 62
            || :.|.:.|..|..|..::.:..:|..||.:..:.:     .:...||.|:.||...||..|..
  Fly    92 HPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKD 156

  Fly    63 GLDGRTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFA 127
            ...|..|.|||.||:.|..:.|.:         ...|..||.:.||...|....     .||...
  Fly   157 SCSGIEVDGRRIRVDFSITQRAHT---------PTPGVYLGRQPRGKAPRSFSP-----RRGRRV 207

  Fly   128 RHCRER------KARQRRRSNSFSRS--RSTSRRRRTRSKSGTRSRS 166
            .|.|..      :.|...|::.:.|:  ||.||.|.||::|.:||||
  Fly   208 YHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 22/76 (29%)
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 23/78 (29%)

Return to query results.
Submit another query.