DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Srsf7

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001034124.2 Gene:Srsf7 / 362687 RGDID:1307425 Length:238 Species:Rattus norvegicus


Alignment Length:271 Identity:121/271 - (44%)
Similarity:141/271 - (52%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGR 67
            |:..:.|||||:||..|.|.:||..|..||.||:||||||||||||||||..|||.||||||||:
  Rat     6 RYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK 70

  Fly    68 TVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGR---GDDKCYECGGRGHFA-- 127
            .:||.|.|||||||...||                 ..||....|   .:|:|||||.:||:|  
  Rat    71 VICGSRVRVELSTGMPRRS-----------------RFDRPPARRPFDPNDRCYECGEKGHYAYD 118

  Fly   128 --RHCRERKARQRRRSNS------FSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRS-GRSNGRD 183
              |:.|.|::|.|.||:|      :|||||.||.||:||.|..||||.|.    ||| ..|..|.
  Rat   119 CHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSL----RRSRSASLRRS 179

  Fly   184 ENGS--ASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRR 246
            .:||  .|||.                      :...|.|...||.||.||:....|..||.|.|
  Rat   180 RSGSIIGSRYF----------------------QSRSRSRSRSRSISRPRSSRSKSRSPSPKRSR 222

  Fly   247 GDS-SASRSVS 256
            ..| |..||.|
  Rat   223 SPSGSPHRSAS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 53/78 (68%)
RRM_SRSF3_like 9..81 CDD:240819 51/71 (72%)
Srsf7NP_001034124.2 RRM_SRSF7 12..88 CDD:410050 53/75 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353906
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4023
OMA 1 1.010 - - QHG46644
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - otm45427
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.