Sequence 1: | NP_723226.1 | Gene: | x16 / 33967 | FlyBaseID: | FBgn0028554 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014207.2 | Gene: | Srsf6 / 362264 | RGDID: | 1359241 | Length: | 339 | Species: | Rattus norvegicus |
Alignment Length: | 334 | Identity: | 101/334 - (30%) |
---|---|---|---|
Similarity: | 133/334 - (39%) | Gaps: | 89/334 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
Fly 74 ARVELSTGKYARSGG---GGGGGGGGGGGGGLGGRDRGG-------------------------- 109
Fly 110 ---GG--------------------------RGDDKC--YECGGR------------------GH 125
Fly 126 FARHCRERKARQRRRSNSFSRSRSTSR-RRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSAS 189
Fly 190 RYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASP------AVRRGSPPRRRGD 248
Fly 249 SSASRSVSR 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
x16 | NP_723226.1 | RRM | <1..>82 | CDD:223796 | 29/72 (40%) |
RRM_SRSF3_like | 9..81 | CDD:240819 | 29/71 (41%) | ||
Srsf6 | NP_001014207.2 | RRM_SF | 1..72 | CDD:418427 | 29/71 (41%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..103 | 9/27 (33%) | |||
RRM2_SRSF6 | 110..182 | CDD:410159 | 7/71 (10%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..339 | 54/158 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |