DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Srsf6

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001014207.2 Gene:Srsf6 / 362264 RGDID:1359241 Length:339 Species:Rattus norvegicus


Alignment Length:334 Identity:101/334 - (30%)
Similarity:133/334 - (39%) Gaps:89/334 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :||:|.|..|.|:.|::..|..||.|..:.:..   |:.|||||.:|||.|||..|:.:.:||.|
  Rat     3 RVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKN---GYGFVEFEDSRDADDAVYELNSKELCGER 64

  Fly    74 ARVELSTGKYARSGG---GGGGGGGGGGGGGLGGRDRGG-------------------------- 109
            ..||.:.|......|   |...||||.......|||:.|                          
  Rat    65 VIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDF 129

  Fly   110 ---GG--------------------------RGDDKC--YECGGR------------------GH 125
               .|                          |..||.  .|..||                  |.
  Rat   130 MRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGS 194

  Fly   126 FARHCRERKARQRRRSNSFSRSRSTSR-RRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSAS 189
            .:|....|::|.|.|.:|.|||||.|: |.|:||:|..||||||.|...|...:|..:.:.||.|
  Rat   195 RSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHS 259

  Fly   190 RYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASP------AVRRGSPPRRRGD 248
            ......::..|...|....:...|:...| ::...||||:|||.||      ..|..|||.:|..
  Rat   260 HSRSRSKDKYGKSRSRSRSRSPKENGKGD-IKSKSRSRSQSRSHSPLPAPPSKARSMSPPPKRAS 323

  Fly   249 SSASRSVSR 257
            .|.|||.||
  Rat   324 RSRSRSRSR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 29/72 (40%)
RRM_SRSF3_like 9..81 CDD:240819 29/71 (41%)
Srsf6NP_001014207.2 RRM_SF 1..72 CDD:418427 29/71 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 9/27 (33%)
RRM2_SRSF6 110..182 CDD:410159 7/71 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..339 54/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.