DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Srsf3

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001041372.1 Gene:Srsf3 / 361814 RGDID:1309233 Length:164 Species:Rattus norvegicus


Alignment Length:194 Identity:96/194 - (49%)
Similarity:106/194 - (54%) Gaps:53/194 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTV 69
            |.|.|||||:||||..|.:||..||.||.|||||:|||||||||||||..||||||||.|||||:
  Rat     7 PLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTL 71

  Fly    70 CGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRG-----GGGRGDDKCYECGGRGHFARH 129
            ||.|.|||||.|: .||                  |:||     |....||         :..|.
  Rat    72 CGCRVRVELSNGE-KRS------------------RNRGPPPSWGRRPRDD---------YRRRS 108

  Fly   130 CRERKARQRRRSNSFSRSRSTSR-RRRTR----------SKSGTRSRSRSAGSVGRRSGRSNGR 182
            ...|:...||||.|.|||||.|| |||.|          |:|.:||||||         |||.|
  Rat   109 PPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRS---------RSNER 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 57/76 (75%)
RRM_SRSF3_like 9..81 CDD:240819 55/71 (77%)
Srsf3NP_001041372.1 RRM_SRSF3 6..86 CDD:241089 58/79 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 105 1.000 Domainoid score I6537
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - otm45427
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.