DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Tial1

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001013211.1 Gene:Tial1 / 361655 RGDID:1595845 Length:392 Species:Rattus norvegicus


Alignment Length:91 Identity:24/91 - (26%)
Similarity:42/91 - (46%) Gaps:13/91 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PSDRK--------VYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARD 56
            ||.:|        |:||||.......|::..|..:|.:....:.::     ..|:.||.|.:..|
  Rat   103 PSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLD 167

  Fly    57 AADAVRGLDGRTVCGRRARVELSTGK 82
            |.:|:..:.|:.:.||:.|...:|.|
  Rat   168 AENAIVHMGGQWLGGRQIRTNWATRK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 20/84 (24%)
Tial1NP_001013211.1 RRM1_TIAR 10..107 CDD:410028 2/3 (67%)
RRM2_TIAR 113..192 CDD:410029 19/78 (24%)
RRM3_TIAR 222..294 CDD:241064
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.