DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srsf4

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_955868.1 Gene:srsf4 / 321872 ZFINID:ZDB-GENE-030131-591 Length:366 Species:Danio rerio


Alignment Length:327 Identity:112/327 - (34%)
Similarity:137/327 - (41%) Gaps:99/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :||||.|...||:.|:|..|..||.:..|.:..   |:.||||:..|||.|||..|:|:.:||:|
Zfish     3 RVYVGKLSYRAREKDVERFFKGYGKILEVDLKN---GYGFVEFDDPRDADDAVYDLNGKDLCGKR 64

  Fly    74 ARVELSTGKYARSGGGGGG-----GGGGGGGGGLGGRDR-GGGGRGD------------------ 114
            ..||.:.|: .|.||...|     |.|||||||    || |...|.|                  
Zfish    65 VIVEHTIGQ-RRDGGNRSGRSNRYGRGGGGGGG----DRYGPPTRTDYRLIVENLSSRCSWQDLK 124

  Fly   115 DKCYECG---------GR---------------------------GHFARHCRERKARQRRR--S 141
            |...:.|         ||                           |...|...:|...:|||  |
Zfish   125 DYMRQAGEVTYADTNKGRKNEGVIEFRQYSDMKRALEKLDGTEVNGRKIRLIEDRPGARRRRSYS 189

  Fly   142 NSFSRSRSTSRR-RRTRSKSGTRSRSRSAGSVGR----------RSGR----SNGRDENGSASRY 191
            .|.|||||.||| ||:||.|.|.|||.::||..|          ||.|    |||..:.|.:.|.
Zfish   190 RSASRSRSRSRRSRRSRSHSRTSSRSGASGSRSRSRSTSKKAKSRSSRMEESSNGARKGGDSGRD 254

  Fly   192 SDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGSPPRRRGDSSASRSVS 256
            :...|       ||...|.:.|::     ||...|||||||.|...|..|  |..|..|...|.|
Zfish   255 NSLSR-------SPQNKKSKRENK-----RGRSDSRSRSRSKSRNDRDLS--RESGSKSQEASKS 305

  Fly   257 RD 258
            .|
Zfish   306 GD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 31/72 (43%)
RRM_SRSF3_like 9..81 CDD:240819 31/71 (44%)
srsf4NP_955868.1 RRM1_SRSF4_like 3..72 CDD:240783 31/71 (44%)
RRM2_SRSF4_like 107..178 CDD:241044 6/70 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.