DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and HNRNPC

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001070910.1 Gene:HNRNPC / 3183 HGNCID:5035 Length:306 Species:Homo sapiens


Alignment Length:249 Identity:62/249 - (24%)
Similarity:97/249 - (38%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGN-NARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGR 72
            :|::|:|.. ..:|:|:|.:|..||.:....:.:   |||||::.:.|:|..||.|.|||.:.|:
Human    17 RVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHK---GFAFVQYVNERNARAAVAGEDGRMIAGQ 78

  Fly    73 RARVELSTGKYARSGGGGGGGGGGGGGGGL-----------GGRDRGGGGRGD--DKCYECGGR- 123
            ...:.|:.......|..|.........|.:           ...|.....:.|  |:.|....| 
Human    79 VLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARV 143

  Fly   124 ---GHFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDEN 185
               ...||.....| |||...|       |||    |.|||..|:|...||  .:||:..|.|..
Human   144 PPPPPIARAVVPSK-RQRVSGN-------TSR----RGKSGFNSKSGQRGS--SKSGKLKGDDLQ 194

  Fly   186 GSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRR 239
            ......:..::.    |||......:.|.|...:.......:|....:|.:|::
Human   195 AIKKELTQIKQK----VDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 24/73 (33%)
RRM_SRSF3_like 9..81 CDD:240819 24/72 (33%)
HNRNPCNP_001070910.1 RRM_hnRNPC 10..93 CDD:410015 24/78 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..190 21/64 (33%)
Nuclear localization signal. /evidence=ECO:0000255 155..161 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..306 3/24 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S3571
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.