DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Srsf5

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_038967784.1 Gene:Srsf5 / 29667 RGDID:3664 Length:270 Species:Rattus norvegicus


Alignment Length:318 Identity:89/318 - (27%)
Similarity:115/318 - (36%) Gaps:137/318 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            :|::|.|...||:.|:|..|..||.:|.:.:.|   ||.|||||..|||.|||..|||:.:|..|
  Rat     5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKR---GFGFVEFEDPRDADDAVYELDGKELCSER 66

  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRG------------------------- 113
            ..:|     :||:                  |.|||.|||                         
  Rat    67 VTIE-----HARA------------------RSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTEN 108

  Fly   114 ----------------DDKCYECG--------------GRGHFA--------------------- 127
                            .|...:.|              |...||                     
  Rat   109 RLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRK 173

  Fly   128 --------RHCRER-KARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRD 183
                    ||.|.| ::|.|.||:|.|||||.|||.::.|:|.:||||||....|.||.......
  Rat   174 IKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRRSKSYSRSRSRSRSRSKSRSGSRSPVPEKSQ 238

  Fly   184 ENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGS 241
            :.||:||     .....:||                     |.||||||.|.:|..|:
  Rat   239 KRGSSSR-----SKSPASVD---------------------RQRSRSRSRSRSVDSGN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 31/72 (43%)
RRM_SRSF3_like 9..81 CDD:240819 31/71 (44%)
Srsf5XP_038967784.1 RRM1_SRSF5 5..74 CDD:410008 32/76 (42%)
RRM2_SRSF5 99..179 CDD:410158 5/79 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.