DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and srp1

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_596398.1 Gene:srp1 / 2539818 PomBaseID:SPBC11C11.08 Length:275 Species:Schizosaccharomyces pombe


Alignment Length:283 Identity:77/283 - (27%)
Similarity:103/283 - (36%) Gaps:63/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI----ARNPPGFAFVEFESARDAADAV 61
            |||. |.|.:||....:..|..:|.|.|..:|.|....|    .|....|||||:|.:|||.||.
pombe     1 MSRR-SLRTLYVTGFRDGMRARELAYEFEPFGPLIRCDIPIPRTRTSRPFAFVEYEDSRDAEDAY 64

  Fly    62 RGLDGRTVCGRRARVELSTG----KYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGG 122
            ..:.||       |:|...|    ::|:.....|.|...||....|||..|..||       ...
pombe    65 YEVHGR-------RLERGGGVLRVEWAKQPPPSGPGSKRGGRRERGGRVHGDSGR-------LRS 115

  Fly   123 RGHFARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRD---- 183
            |.......|.|......||:  .||.|...|.|:||..|   ||||. ...|||.:.|.|.    
pombe   116 RSPSPHEARSRSPYNDERSD--RRSMSPRYRSRSRSPDG---RSRSP-DYDRRSPKRNHRSPSPV 174

  Fly   184 -----------------ENGSASRYSDHER-------------NGSGAVDSPPPPKRRYEDEDDD 218
                             :||.......:|:             ||:..|::..|..:....::..
pombe   175 SFAPQKSPVENETETNVDNGDTKISESNEKSGTEVEQQSAPNSNGNEEVNNLEPVGQNESKQEPP 239

  Fly   219 RVRGSPRSRSRSRSASPAVRRGS 241
            :...|..|:.:...|.|.|...|
pombe   240 KEENSNVSQEQPEQAQPEVSAAS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 31/88 (35%)
RRM_SRSF3_like 9..81 CDD:240819 25/75 (33%)
srp1NP_596398.1 RRM_Srp1p_like 8..85 CDD:240913 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.