DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SPBC1861.04c

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_596721.1 Gene:SPBC1861.04c / 2539617 PomBaseID:SPBC1861.04c Length:1014 Species:Schizosaccharomyces pombe


Alignment Length:75 Identity:22/75 - (29%)
Similarity:37/75 - (49%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIAR---NPPGFAFVEFESARDAADAVRGLDGRTV 69
            |::||.::.....:.|:|..|..||.:.||.|.:   ...||.:|...:.:||.:|:... |:.:
pombe   757 RELYVTNIDFKVNEKDVETFFRDYGQVESVRIPKRFNQHKGFGYVVMTTNQDAENALSAA-GKQL 820

  Fly    70 CGRRARVELS 79
            ..|...|.||
pombe   821 GNRVLNVVLS 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 22/75 (29%)
RRM_SRSF3_like 9..81 CDD:240819 21/74 (28%)
SPBC1861.04cNP_596721.1 RRM1_Prp24 590..662 CDD:240742
RRM2_Prp24 666..743 CDD:240743
RRM3_Prp24 757..829 CDD:240744 20/72 (28%)
RRM4_Prp24 874..943 CDD:240745
Lsm_interact 996..1014 CDD:283133
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.