DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and CSTF2T

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_056050.1 Gene:CSTF2T / 23283 HGNCID:17086 Length:616 Species:Homo sapiens


Alignment Length:75 Identity:24/75 - (32%)
Similarity:39/75 - (52%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAADAVRGLDGR 67
            |.|:||::...|.:..|:.:|...||:.|..:..:     |.|:.|.|::....|..|:|.|:||
Human    16 RSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGR 80

  Fly    68 TVCGRRARVE 77
            ...||..||:
Human    81 EFSGRALRVD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 23/74 (31%)
CSTF2TNP_056050.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 24/75 (32%)
CSTF2_hinge 112..191 CDD:433869
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..241
PRK12323 <242..>387 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..418
9 X 5 AA tandem repeats of M-E-T-R-[AG] 418..462
9 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 505..549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..573
CSTF_C 572..612 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.