DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Rbm3

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_058089.2 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:181 Identity:57/181 - (31%)
Similarity:80/181 - (44%) Gaps:43/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARN-----PPGFAFVEFESARDAADAVRGLDGRT 68
            |::||.|..|..:..||..|.::|.:..|.:.::     ..||.|:.|.:...|:||:|.::|.:
Mouse     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASDAMRAMNGES 71

  Fly    69 VCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRG-GGGRGDDKCYECGGRGHFARHCRE 132
            :.||:.||: ..||.|| |..||..||.|.....||.|:| |.||.|.:   .||.|:       
Mouse    72 LDGRQIRVD-HAGKSAR-GSRGGAFGGRGRSYSRGGGDQGYGSGRYDSR---PGGYGY------- 124

  Fly   133 RKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRD 183
                      .:.|||..|              .||.|...|.|| .|.||
Mouse   125 ----------GYGRSRDYS--------------GRSQGGYDRYSG-GNYRD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 23/76 (30%)
Rbm3NP_058089.2 RRM_CIRBP_RBM3 6..85 CDD:409883 24/78 (31%)

Return to query results.
Submit another query.