DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Y57G11A.5

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_502757.2 Gene:Y57G11A.5 / 190364 WormBaseID:WBGene00013293 Length:110 Species:Caenorhabditis elegans


Alignment Length:76 Identity:32/76 - (42%)
Similarity:53/76 - (69%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RHPSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGR 67
            |:..:|:||||::..:|.:.::|.||...|.::|:|:|:.|||||||.|:....|.|||:.|:|:
 Worm    12 RNVENRQVYVGNMPFDATEKEIEAVFSVMGPIKSIWMAKRPPGFAFVTFKRTVHAFDAVKYLNGK 76

  Fly    68 TVCGRRARVEL 78
            .:|...|:||:
 Worm    77 KICDLEAKVEM 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 32/76 (42%)
RRM_SRSF3_like 9..81 CDD:240819 30/70 (43%)
Y57G11A.5NP_502757.2 RRM_SF 19..87 CDD:388407 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.