DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and rsp-6

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_741446.1 Gene:rsp-6 / 177566 WormBaseID:WBGene00004703 Length:179 Species:Caenorhabditis elegans


Alignment Length:231 Identity:104/231 - (45%)
Similarity:121/231 - (52%) Gaps:56/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCG 71
            |.|||||.|.::|...:||.:|..:|.:|.||:||.||||||||::..|||.||||.|||..:||
 Worm     2 DAKVYVGGLPSDATSQELEEIFDRFGRIRKVWVARRPPGFAFVEYDDVRDAEDAVRALDGSRICG 66

  Fly    72 RRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRER-KA 135
            .|||||||||:  |.||||.|||.||.||  ||||| ...|||        ||......|:| :.
 Worm    67 VRARVELSTGQ--RRGGGGRGGGFGGRGG--GGRDR-SPYRGD--------RGRSRSRSRDRGRD 118

  Fly   136 RQRRRSNSFSRSRSTSR-RRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERNGS 199
            |.|.||...||.||..| |.|:|.:..|||||||                               
 Worm   119 RSRDRSRDRSRDRSRDRSRERSRERERTRSRSRS------------------------------- 152

  Fly   200 GAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASP 235
                    |:.|  |....:.|...|||||||||||
 Worm   153 --------PQER--DRSHSKSRSRSRSRSRSRSASP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 45/74 (61%)
RRM_SRSF3_like 9..81 CDD:240819 43/71 (61%)
rsp-6NP_741446.1 RRM <2..>75 CDD:223796 43/72 (60%)
RRM_SRSF3_like 4..75 CDD:240819 42/70 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5038
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I2915
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46644
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.