DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and grld-1

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_741283.1 Gene:grld-1 / 176827 WormBaseID:WBGene00017929 Length:520 Species:Caenorhabditis elegans


Alignment Length:62 Identity:18/62 - (29%)
Similarity:34/62 - (54%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTV 69
            |:::||.||:...|..|:..||.:|.:.::......| :|:|.:|:...:.:|.|.|.|..:
 Worm   251 RRLFVGGLGSWCDKEILQKAFGEFGFVENIDYDHGQP-YAYVVYENTHTSQEACRSLRGACI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 18/62 (29%)
RRM_SRSF3_like 9..81 CDD:240819 17/61 (28%)
grld-1NP_741283.1 RRM_SF 33..>93 CDD:302621
RRM_SF 167..246 CDD:302621
RRM3_Spen 253..324 CDD:240756 17/60 (28%)
SPOC 376..482 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.