DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and rnp-7

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:262 Identity:61/262 - (23%)
Similarity:84/262 - (32%) Gaps:111/262 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI----ARNPPGFAFVEFESARDAADAVRGLDGRT 68
            |.::||.:.....::.|...|.|||.::.:.:    |..|.|:||:|:....:...|.:..||..
 Worm   104 RTLFVGRINYETSESKLRREFEAYGKIKKLTMVHDEAGKPRGYAFIEYSDKAEMHTAYKKADGIK 168

  Fly    69 VCGRRARVELSTGKYAR------------------------------SGGGGG------------ 91
            |.|:|..|:...|:..:                              ||.|||            
 Worm   169 VDGKRLVVDYERGRTQKTWLPRRLGGGKGDTRKTREAKSVIEEREIASGFGGGYEDRDRERSGSR 233

  Fly    92 ---------GGG----------------GGGGGGGLGGRDR-----GGGGRGDDKCYECGGRGHF 126
                     |||                |||||.|.|||||     ||||.|.|:  :.||    
 Worm   234 DRRQDSYRNGGGNDRDRRESSGGFRDNRGGGGGFGGGGRDRFNDRSGGGGYGGDR--DRGG---- 292

  Fly   127 ARHCRERKARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRY 191
                                       .|...:.|:|..:......|.|||  .|....|...||
 Worm   293 ---------------------------DRGGDRGGSRYSTGGGSGGGYRSG--GGSSGGGGGGRY 328

  Fly   192 SD 193
            .|
 Worm   329 GD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 20/75 (27%)
rnp-7NP_498565.2 U1snRNP70_N 4..95 CDD:432406
RRM_snRNP70 103..192 CDD:409682 22/87 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.