DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and rsp-5

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_495307.3 Gene:rsp-5 / 174073 WormBaseID:WBGene00004702 Length:208 Species:Caenorhabditis elegans


Alignment Length:265 Identity:85/265 - (32%)
Similarity:110/265 - (41%) Gaps:91/265 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73
            ::|:|.:..|||:.|:|.....||.:.::.:..   |||||:||.:|||.||...|||:|:.|..
 Worm     3 RLYLGKIPYNARERDVERFLKGYGKINNISMKY---GFAFVDFEDSRDAEDACHDLDGKTMEGSS 64

  Fly    74 AR--VELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRGHFARHCRERKAR 136
            .|  ||::.||                            .||:|:        |.:|..|.|...
 Worm    65 MRLVVEMARGK----------------------------PRGNDR--------HGSRSPRRRSRS 93

  Fly   137 QRRRSNS----FSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRDENGSASRYSDHERN 197
            .||||.:    .||||...|.||:||:|.:||||....|..|...||                  
 Worm    94 PRRRSRTPPRRRSRSRDRKRSRRSRSRSSSRSRSPVRESRRRSESRS------------------ 140

  Fly   198 GSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPA-----VRRGSPPRRRGDS----SASR 253
                    |.|||..:           |..|||||..||     .|.||||:..||.    |..|
 Worm   141 --------PSPKRDLK-----------REASRSRSPLPAKDRSRTRSGSPPKNGGDRKRSVSRGR 186

  Fly   254 SVSRD 258
            |.|||
 Worm   187 SHSRD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 29/74 (39%)
RRM_SRSF3_like 9..81 CDD:240819 29/73 (40%)
rsp-5NP_495307.3 RRM <3..>77 CDD:223796 31/104 (30%)
RRM_SF 3..74 CDD:302621 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.