DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and tiar-1

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_495121.1 Gene:tiar-1 / 173967 WormBaseID:WBGene00015943 Length:408 Species:Caenorhabditis elegans


Alignment Length:122 Identity:39/122 - (31%)
Similarity:60/122 - (49%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRRA 74
            ||||::. :..::::...|.::|.:..|.|.: ..|:|||:|::...||.|:..::.:.|.|:..
 Worm   243 VYVGNIA-SLTEDEIRQGFASFGRITEVRIFK-MQGYAFVKFDNKDAAAKAIVQMNNQDVGGQLV 305

  Fly    75 RVEL----STGK---------YARSGGGG------GGGGGGGGGGGLGGRDRGGGGR 112
            |...    .|||         |..|..||      |.||||..|||.||...||.|:
 Worm   306 RCSWGKTGDTGKTPGGSYGYGYGNSSSGGNSQPYSGYGGGGAYGGGQGGGGHGGPGQ 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 19/74 (26%)
tiar-1NP_495121.1 PABP-1234 47..>302 CDD:130689 17/60 (28%)
RRM2_TIA1_like 136..210 CDD:409789
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.