DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and CSTF2

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001293135.1 Gene:CSTF2 / 1478 HGNCID:2484 Length:597 Species:Homo sapiens


Alignment Length:75 Identity:25/75 - (33%)
Similarity:38/75 - (50%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKVYVGDLGNNARKNDLEYVFGAYG---SLRSVWIAR--NPPGFAFVEFESARDAADAVRGLDGR 67
            |.|:||::...|.:..|:.:|...|   |.|.|:...  .|.|:.|.|::....|..|:|.|:||
Human    16 RSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGR 80

  Fly    68 TVCGRRARVE 77
            ...||..||:
Human    81 EFSGRALRVD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808 24/74 (32%)
CSTF2NP_001293135.1 PABP-1234 4..352 CDD:130689 25/75 (33%)
RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/75 (33%)
CSTF2_hinge 112..191 CDD:433869
PHA03378 <253..455 CDD:223065
CSTF_C 553..593 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.