DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SRSF12

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_542781.3 Gene:SRSF12 / 135295 HGNCID:21220 Length:261 Species:Homo sapiens


Alignment Length:281 Identity:76/281 - (27%)
Similarity:118/281 - (41%) Gaps:68/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRH--PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI-----ARNPPGFAFVEFESARDAA 58
            |||:  |.:..:::.::.:..|..||...||.||.:..|:|     .|.|.|||:|:||..|||.
Human     1 MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAE 65

  Fly    59 DAVRGLDGRTVCGRRARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDK-CYECGG 122
            ||:..|:.:.||||:..::.:.|                        ||...|:...| .:.|..
Human    66 DALYNLNRKWVCGRQIEIQFAQG------------------------DRKTPGQMKSKERHPCSP 106

  Fly   123 RGH------FARHCRERKA---RQRRRSNSF------------SRSRSTSRRRRTRSKSGTRSRS 166
            ..|      ..|..|.|.:   |.||||:|.            |:|||.|..||:.|...:|:..
Human   107 SDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPR 171

  Fly   167 RSAGSVGR--------------RSGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDD 217
            |:.||.||              :|..|:.:.:..|.::...|.|:......||....:.|.: .:
Human   172 RNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTN-SE 235

  Fly   218 DRVRGSPRSRSRSRSASPAVR 238
            .:|:.:..|..||.|.|.:.|
Human   236 TKVQTAKHSHFRSHSRSRSYR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 31/87 (36%)
RRM_SRSF3_like 9..81 CDD:240819 27/76 (36%)
SRSF12NP_542781.3 RRM_SRSF10_SRSF12 10..93 CDD:240758 30/106 (28%)
PABP-1234 <12..211 CDD:130689 60/222 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..261 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.