DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and Caper

DIOPT Version :10

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_317010.4 Gene:Caper / 1277542 VectorBaseID:AGAMI1_007869 Length:595 Species:Anopheles gambiae


Alignment Length:182 Identity:52/182 - (28%)
Similarity:66/182 - (36%) Gaps:36/182 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DRGGGGRGDDKCYECGGRGHFARHCRERKARQRRRSNSFSRSRSTSRRR---RTRSKSGTR-SRS 166
            :.|....|:.|..| .|....:||....:.|:|.|.....|.|...|.|   |.|.:.|.: |:.
Mosquito    51 ENGATTNGEKKSKE-NGHSKSSRHRSRSRERERERERDRDRERDRERERERDRERDRDGEKASKK 114

  Fly   167 RSAGSVGRRSGRSNGRDENGSASR------------------YSDHERNGSGAVDSPPPPKRRYE 213
            ..:||.||...:...|.::.|.||                  .|||.|. ...|:     |||..
Mosquito   115 HRSGSPGRNRDKERRRSKDRSKSRSPARRDRSKDRSKEKDRGKSDHHRR-EVVVE-----KRRSR 173

  Fly   214 DEDDDRVRGSPRS---RSRSRSASPAVRRG----SPPRRRGDSSASRSVSRD 258
            |..|.|.|...|.   |||||.....:.||    ||...||.........||
Mosquito   174 DRVDHRRRSRERDYRRRSRSRDGGRGMGRGRRSMSPKPYRGRGRGGSGYYRD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM_SRSF3_like 9..81 CDD:409808
CaperXP_317010.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.