DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment x16 and SRSF10

DIOPT Version :9

Sequence 1:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:286 Identity:93/286 - (32%)
Similarity:130/286 - (45%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRH--PSDRKVYVGDLGNNARKNDLEYVFGAYGSLRSVWI-----ARNPPGFAFVEFESARDAA 58
            |||:  |.:..::|.::.::.|..||...||.||.:..|::     .|.|.|||:|:||..|||.
Human     1 MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAE 65

  Fly    59 DAVRGLDGRTVCGRRARVELSTG-------KYARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDK 116
            ||:..||.:.:|||:..::.:.|       ..|:.                 ||:.....|.|| 
Human    66 DALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE-----------------GRNVYSSSRYDD- 112

  Fly   117 CYECGGRGHFARHCRERKARQR------RRSNSFSRSRSTSRRRRTRS-------KSGTRSRSRS 168
             |:...|.. :|....|::|.|      |||.|...||.|.|.||:||       |...||.|||
Human   113 -YDRYRRSR-SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRS 175

  Fly   169 AGSVGRRSGRSNGRDE--NGSASRYSDHER-NGSGAVDSPPPPK--RRYEDEDDDRVRGSPRSRS 228
            ..:...|| :|..:.|  ..|.||.:.|.: .|:...||....|  .|||.|  .|.:..|||:|
Human   176 KSNSRSRS-KSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKE--SRKKEPPRSKS 237

  Fly   229 RSRSASPAVRRGSPPRRRGDSSASRS 254
            :|||.|   |..|..|.|..:|...|
Human   238 QSRSQS---RSRSKSRSRSWTSPKSS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
x16NP_723226.1 RRM <1..>82 CDD:223796 32/94 (34%)
RRM_SRSF3_like 9..81 CDD:240819 27/76 (36%)
SRSF10NP_473357.1 RRM_SF 5..99 CDD:418427 29/93 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262 54/152 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.