DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nop5 and Prpf31

DIOPT Version :9

Sequence 1:NP_477412.1 Gene:nop5 / 33966 FlyBaseID:FBgn0026196 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_081604.3 Gene:Prpf31 / 68988 MGIID:1916238 Length:499 Species:Mus musculus


Alignment Length:417 Identity:95/417 - (22%)
Similarity:178/417 - (42%) Gaps:98/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KKTLKKLLVDDVQSSLLVADAKLGTAIKDKLSVQCVCNTGVQELMRCIRQQADSLLGGLPKREMT 137
            ::|...|..|.|:|...:.|:|:...|..|:.........|.|:|                    
Mouse    37 EETQLDLSGDSVKSIAKLWDSKMFAEIMMKIEEYISKQANVSEVM-------------------- 81

  Fly   138 AMALGLAHSLSRYKLKFSPDKIDTMIVQAQCLLDDLDKELNNYMMRAREWYGWHFPELGKIITDN 202
                |...:...|:          :||.|..|..:::.|||......|:.|...||||..::.:.
Mouse    82 ----GPVEAAPEYR----------VIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNA 132

  Fly   203 IAFVKTIKLVGT-----RDNMATSDLSDILPEDVEEKVKEAAEISMGTEISEEDVLNIQCLCDEI 262
            :.:::|:|.:|.     ::|   .:|..||.......|...|..:.|.::|:|::..::..||..
Mouse   133 LDYIRTVKELGNSLDKCKNN---ENLQQILTNATIMVVSVTASTTQGQQLSDEELERLEEACDMA 194

  Fly   263 ISINDYRTHLYDYLKARMMAMAPNLTVLVGDTVGARLIAHAGSLINLAKHPSSTVQILGAEKALF 327
            :.:|..:..:|:|:::||..:||||::::|.:..|:::..||.|.||:|.|:..:.:|||::...
Mouse   195 LELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTL 259

  Fly   328 RALKTKKDTPKYGLIYHAQLVGQASQKNKGKMSRSLAAKASLATRVDAFGEEATFELGAAHKVKL 392
            ....:....|..|.|||:.:|.......:.|.:|.:|||.:||.|||:|.|....::|       
Mouse   260 SGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVG------- 317

  Fly   393 ESRLRLLEEGNLRKLSGTGKAKAKFEKYQAKSEVFTYQPEADNTLNVKKKRKHSESEQQTPVKKE 457
                                       |:.|.|:               :||..:.::..|||:.
Mouse   318 ---------------------------YELKDEI---------------ERKFDKWQEPPPVKQV 340

  Fly   458 EPAEEEAEVKSEKKKK-----KKKKQK 479
            :|.  .|.:..::||:     :|.|::
Mouse   341 KPL--PAPLDGQRKKRGGRRYRKMKER 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nop5NP_477412.1 NOP5NT 2..>52 CDD:285382
NOSIC 163..214 CDD:197999 15/50 (30%)
Nop 169..397 CDD:280047 64/232 (28%)
Prpf31NP_081604.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 1/5 (20%)
NOSIC 93..144 CDD:197999 15/50 (30%)
Nop 99..329 CDD:280047 69/281 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..357 7/24 (29%)
Prp31_C 337..465 CDD:286825 8/31 (26%)
Nuclear localization signal (NLS). /evidence=ECO:0000250|UniProtKB:Q8WWY3 351..364 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.