DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wee1 and PEK

DIOPT Version :9

Sequence 1:NP_001260167.1 Gene:Wee1 / 33965 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_649538.1 Gene:PEK / 40653 FlyBaseID:FBgn0037327 Length:1162 Species:Drosophila melanogaster


Alignment Length:591 Identity:109/591 - (18%)
Similarity:165/591 - (27%) Gaps:304/591 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 QAPKRLALHDTN------ISRFKREFMQVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAGSS 278
            ||.:|.....|.      .|||:.:|..:..:|.|.|||||:..|:||...||||:...|...||
  Fly   617 QANQRTISESTTHSGEHYTSRFQSDFELMQCLGRGGFGVVFEAKNKLDENRYAIKRITLPNKESS 681

  Fly   279 FEKRALNEVWAHAVLGKHDNVVRYYSAWAE----------------------------------- 308
             .:|.|.|....|.. :|.|:|||:.:|.|                                   
  Fly   682 -RQRVLREARTLASC-EHHNIVRYFHSWTETPPTGWQEEEDRKLLAHELSTSIQIETPDDSTMPS 744

  Fly   309 ----------------------------------------------------------------- 308
                                                                             
  Fly   745 LTEQLKEKRQQQLLSWVSDAANSTACSHDFHLPGESSLKNIREEYDYDEEEDSLIEFRSESQSAA 809

  Fly   309 ----------DD-------------------------------------HMLIQNEF-------C 319
                      ||                                     |.|:.|.|       .
  Fly   810 LRAEEEDDTDDDYEEDEEQQGDHEKRHRSSVSIDIHSASFDLKNINYSQHQLVSNSFQIESVRPK 874

  Fly   320 DGGSLHAR--------------IQDH-----------------------------------CLGE 335
            ..||..|.              .|:|                                   |..|
  Fly   875 SSGSDDANDDNKARRKPLTLALAQNHNNNQNGSQPTPSSATILNGTVAKPSKVYLYIQMQLCRKE 939

  Fly   336 ---------------AELKIVLMHVIEGLRYIHSNDLVHMDLKPENIFSTMNPNAHKLVEVQPQQ 385
                           |.:..:...:::.:.|:|...|:|.||||.|||.:           |..|
  Fly   940 SLRDWLRDNRSETRAAHIGDIFHQIVDAVDYVHLKGLIHRDLKPSNIFFS-----------QDGQ 993

  Fly   386 TKDDDGMDSVYEELRHSENLVTYKIGDLGHVTSVKEPYVEEGDCRYL-PKEILHEDYSNLFKADI 449
            .|..|  ..:..::....|||. |.||...:.|......:.|...|: |:::|.:.|.  :|.||
  Fly   994 IKIGD--FGLVTDMADIPNLVA-KCGDQSGLPSCARHTQQVGTHLYMSPEQLLGQHYD--YKVDI 1053

  Fly   450 FSLGITLFEAAGGGPLPKNGPEWH--------------NLRDGKVPILPSLSRDF-------NEL 493
            :|||:..||.             |              :||||:.|      :||       .:|
  Fly  1054 YSLGLIFFEL-------------HVYFSTEMERIKTLRSLRDGQYP------KDFAVNYPQQYDL 1099

  Fly   494 IAQMMHPYPDKRPTSQSIFSHPILSAVDSKSKLQLGLELTVEKRKNEILMNKLREAKKQIKLLEQ 558
            :.||:...|::||.::.:           ||:|:..|:|.          :.|.|.:.:...|.:
  Fly  1100 LQQMLSAQPEQRPQTKQL-----------KSQLRNILQLP----------HLLSEGQSEQAELAE 1143

  Fly   559 RVNLLA 564
            |...|:
  Fly  1144 RARRLS 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953 92/517 (18%)
Pkinase 239..515 CDD:278497 92/515 (18%)
PEKNP_649538.1 Luminal_EIF2AK3 73..401 CDD:188874
PKc_like 635..1113 CDD:304357 94/514 (18%)
S_TKc <925..1118 CDD:214567 52/238 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11042
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.