DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wee1 and vito

DIOPT Version :9

Sequence 1:NP_001260167.1 Gene:Wee1 / 33965 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_729096.1 Gene:vito / 326214 FlyBaseID:FBgn0052418 Length:264 Species:Drosophila melanogaster


Alignment Length:179 Identity:34/179 - (18%)
Similarity:58/179 - (32%) Gaps:56/179 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSEHEMS-----VTSLDSSVELRSRSPSPQVFNPRKLRFADDDFDKDTPEGASPQHPLQQRPKLS 64
            |||.:.:     :..:|.....|.|.|.|:              |::.|:.....:  ...|.:.
  Fly   131 QSEEDEADQANRIPGMDFDPNARKRKPKPE--------------DEEEPKATKSNN--STLPDIK 179

  Fly    65 SGEEQQLDSKIGKEGGDGDVSMSPPCQKVRALRLFSTPATPKTILQKSTTQCSNHLSAAAAAVNA 129
            |  ::.||.          :..:...:|:...:||.    .|..|.|...|           ..|
  Fly   180 S--KKDLDR----------LMKTKTLKKMHQSKLFK----QKERLDKKNNQ-----------KKA 217

  Fly   130 SRRSDDLFRLSERPRSLPLHNRKLPTQDTANVNPFTPDSLMAHNKKRCR 178
            .|..::..      :|:|.|.||......||...:....::  |||..|
  Fly   218 KRDRNNTI------KSVPKHQRKQLKYGKANQTKYRKGRMV--NKKELR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953
Pkinase 239..515 CDD:278497
vitoNP_729096.1 Nop25 2..149 CDD:286843 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.