DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wee1 and Pdik1l

DIOPT Version :9

Sequence 1:NP_001260167.1 Gene:Wee1 / 33965 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001101454.1 Gene:Pdik1l / 313609 RGDID:1307476 Length:341 Species:Rattus norvegicus


Alignment Length:339 Identity:75/339 - (22%)
Similarity:119/339 - (35%) Gaps:103/339 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 VNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAGSSFEKRALNEVWA-HAVLGKHDNVVRYYSA 305
            :..:|.|.:|||::.|.|......|:||.:.. |..:.| .||.|.|| .::..:|.||:.....
  Rat    11 IREVGRGSYGVVYEAVIRKTSARVAVKKIRCH-APENVE-LALREFWALSSIKSQHPNVIHLEEC 73

  Fly   306 WAEDDHM---------------LIQN--------------------EFCDGGSLHARIQDHCLGE 335
            ..:.|.|               |::.                    :|||||.::..:.......
  Rat    74 ILQKDGMVQKMSHGSNSSLYLQLVETSLKGEIAFDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNR 138

  Fly   336 AELKIVLMHVIEGLRYIHSNDLVHMDLKPENIFSTMNPNAHKLVEVQPQQTKDDDGMDSVYEELR 400
            ......::.:...|.::|.|.::|.||||:||          |:......|.|.:          
  Rat   139 KTNTSFMLQLSSALAFLHKNQIIHRDLKPDNI----------LISQSRLDTSDLE---------- 183

  Fly   401 HSENLVTYKIGDLG--HVTSVKEPYVEE-------------GDCRYLPKEILHEDYSNLFKADIF 450
                 .|.|:.|.|  .|.|......||             |...|:..|:....|:  .|||||
  Rat   184 -----PTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPEVWEGHYT--AKADIF 241

  Fly   451 SLGITLFEAAGG-------------GPLPKNGPE-----WHNLRDGKVPIL-----PSLSRDFNE 492
            :|||.::.....             |...|.|.|     ...|.:.|:.:|     .|::....:
  Rat   242 ALGIIIWAMLERITFIDTETKKELLGSYVKQGTEIVPVGEALLENPKMELLIPVKKKSMNGRMKQ 306

  Fly   493 LIAQMMHPYPDKRP 506
            ||.:|:...|..||
  Rat   307 LIKEMLAANPQDRP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953 75/339 (22%)
Pkinase 239..515 CDD:278497 75/339 (22%)
Pdik1lNP_001101454.1 STKc_PDIK1L 7..331 CDD:270879 75/339 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.