DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wee1 and LOC108647618

DIOPT Version :9

Sequence 1:NP_001260167.1 Gene:Wee1 / 33965 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_031758734.1 Gene:LOC108647618 / 108647618 -ID:- Length:211 Species:Xenopus tropicalis


Alignment Length:209 Identity:47/209 - (22%)
Similarity:71/209 - (33%) Gaps:87/209 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 GLRYIHSNDLVHMDLKPENIFSTMNPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTYKIGD 412
            ||:|:||..::|.||||:||                               |..||..:  ||.|
 Frog     4 GLQYLHSRGIIHCDLKPDNI-------------------------------LISSEGHI--KIAD 35

  Fly   413 LGHVTSVKEPYVEEGDC------RYLPKEILHEDYSNLFKADIFSLGITLFEAAGGGPLPKNGPE 471
            .|  .:|:..:..:..|      :|:..|:|.:...|. ..|.::.||.|.:.|.|         
 Frog    36 FG--LAVEHVFGHDTTCGYRGTPKYMAPEVLADQRYNA-AVDWWAFGIILCQMATG--------- 88

  Fly   472 WHNLRDGKVPILPSLSRDFNELIAQMMHPYPDKRPTSQSIFSHPILSAVDSKSKLQLGLELTVEK 536
            |                          :|:.||.  ..:...|.||   :.|:|:.     |...
 Frog    89 W--------------------------YPFDDKH--GDAALRHSIL---EDKAKVP-----TWTP 117

  Fly   537 RKNEILMNKLREAK 550
            .|..||:.||...|
 Frog   118 SKLVILLRKLLRKK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953 36/173 (21%)
Pkinase 239..515 CDD:278497 35/172 (20%)
LOC108647618XP_031758734.1 PKc_like <1..207 CDD:419665 47/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.