DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13773 and AT1G75670

DIOPT Version :9

Sequence 1:NP_609081.1 Gene:CG13773 / 33963 FlyBaseID:FBgn0042092 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_565115.1 Gene:AT1G75670 / 843901 AraportID:AT1G75670 Length:196 Species:Arabidopsis thaliana


Alignment Length:163 Identity:36/163 - (22%)
Similarity:67/163 - (41%) Gaps:32/163 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YDSGLDGIVLGI------KNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISR 120
            |:...||::|..      |..|:|   .||.   |...:.:|....:|.||..:.:.|.:..||.
plant    38 YNETFDGVLLAYDATVKSKQAKIL---TGLH---PYFGVRVNTRLLLFDPKPKSFVEGKIVKISP 96

  Fly   121 HHVSAVI------------------YRVFNTSIRFTNQSASREDIAMDQEIKIRIKNFDISNLMP 167
            ..:..::                  |||.:....|.::|..|..:.:...:::::::|| ..:| 
plant    97 ESIHVIVLGFSAAVITDVDIREEFKYRVRDGEGSFVSRSHKRHALKLGTMLRLQVQSFD-EEVM- 159

  Fly   168 YIEGELLLENGEAPKNKSIKFGSPPPEEKEVKK 200
            :|.|.||.||....|....|.....|.:::.|:
plant   160 HIAGSLLPENTGCVKWLEKKSEEALPTDRDHKR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13773NP_609081.1 RNAP_I_Rpa43_N 19..107 CDD:239820 13/50 (26%)
AT1G75670NP_565115.1 RNAP_Rpb7_N_like <15..82 CDD:413996 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4134
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1196232at2759
OrthoFinder 1 1.000 - - FOG0005094
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103646
Panther 1 1.100 - - LDO PTHR12709
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.