DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13773 and Polr1f

DIOPT Version :9

Sequence 1:NP_609081.1 Gene:CG13773 / 33963 FlyBaseID:FBgn0042092 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_758457.1 Gene:Polr1f / 28071 MGIID:106292 Length:330 Species:Mus musculus


Alignment Length:272 Identity:66/272 - (24%)
Similarity:116/272 - (42%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELENYAS------SPESCVRCITTDMHLAMGPYGMANFKHALHEL----LIRTKVGFYDSGLDGI 69
            ||.:||:      |..||:.......|:|:.|..::..:..:.|.    |:|     |...|.|:
Mouse    30 ELPSYAAACALVGSRYSCLVAAPHRRHIALSPRYLSRKRTGIREQLDAELLR-----YSESLLGV 89

  Fly    70 VLGIKNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISRHHVSAVIYRVFNTS 134
            .:...||:|:|:...:..|...:||.|.|||.:|.|:.|..|.|.|..:|..|:..:::..||.|
Mouse    90 PIAYDNIRVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQTLMGTVNKVSSSHIGCLVHGCFNAS 154

  Fly   135 IRFTNQSASRE----DIAMDQEIKIRIKNFDISNLMPYIEGELLLENGEAPKNKSIKFGS----- 190
            |....|.:..|    :|.:..|::     ||:..|.....|...:....:..:..:|..:     
Mouse   155 IPKPEQMSYEEWQTLEIHVGDELE-----FDVFRLDSDSAGVFCIRGKLSTTSLQLKHSAVSEDV 214

  Fly   191 -----------PPPEEKEVKKEDPDE--MLDALITEIKKEPEFTPRKKTSTKRKNGENG---DTT 239
                       .|.::|:.|.:|.|.  .:|: :||:....:.||:::|.....:..|.   :..
Mouse   215 AETVVEEVVEKTPKKKKKKKDKDTDTCGTVDS-VTEVADVTDVTPQEETDIPCSDNVNDFFEEEP 278

  Fly   240 KTKKVKKEIKSE 251
            |.||.||:...|
Mouse   279 KKKKKKKKRHQE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13773NP_609081.1 RNAP_I_Rpa43_N 19..107 CDD:239820 27/97 (28%)
Polr1fNP_758457.1 RNAP_I_Rpa43_N 43..126 CDD:239820 24/87 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..330 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4134
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5307
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55470
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005094
OrthoInspector 1 1.000 - - oto94087
orthoMCL 1 0.900 - - OOG6_103646
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1174
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.