DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13773 and Rpb7

DIOPT Version :9

Sequence 1:NP_609081.1 Gene:CG13773 / 33963 FlyBaseID:FBgn0042092 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_731983.1 Gene:Rpb7 / 261631 FlyBaseID:FBgn0051155 Length:173 Species:Drosophila melanogaster


Alignment Length:137 Identity:34/137 - (24%)
Similarity:55/137 - (40%) Gaps:26/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GPYGMANFKHALHELLIRTKVGFYDSGLDGIVLGIKNIKVLGQTAGLRADDPTMHLVINADFY-- 101
            ||..:...|..|:..:..|..|.|     |.|:.:..|..:|  :|:  ..|....|:....|  
  Fly    19 GPQLLETVKQKLYSEVEGTCTGKY-----GFVIAVTTIDQIG--SGV--IQPGQGFVVYPVKYKA 74

  Fly   102 -VFRPKAGAILSGVVRHISRHHVSAVI--------YRVFNTSIRFTNQ------SASREDIAMDQ 151
             ||||..|.:|..||:.|::..:.|.|        :......::|...      .:..||:.:..
  Fly    75 IVFRPFKGEVLDAVVKQINKVGMFAEIGPLSCFISHHSIPADMQFCPNGNPPCYKSKDEDVVISG 139

  Fly   152 EIKIRIK 158
            |.|||:|
  Fly   140 EDKIRLK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13773NP_609081.1 RNAP_I_Rpa43_N 19..107 CDD:239820 19/70 (27%)
Rpb7NP_731983.1 PTZ00162 1..173 CDD:240298 34/137 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12709
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.