DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13773 and POLR1F

DIOPT Version :9

Sequence 1:NP_609081.1 Gene:CG13773 / 33963 FlyBaseID:FBgn0042092 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001002926.1 Gene:POLR1F / 221830 HGNCID:18027 Length:338 Species:Homo sapiens


Alignment Length:269 Identity:72/269 - (26%)
Similarity:121/269 - (44%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELENYA------SSPESCVRCITTDMHLAMGPYGM----ANFKHALHELLIRTKVGFYDSGLDGI 69
            ||..||      :|..||:.......|:|:.|..:    ...:..|...|:|     |...|.|:
Human    30 ELPTYAAACALVNSRYSCLVAGPHQRHIALSPRYLNRKRTGIREQLDAELLR-----YSESLLGV 89

  Fly    70 VLGIKNIKVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISRHHVSAVIYRVFNTS 134
            .:...||||:|:...:..|...:||.|.|||.:|.|:.|..|.|:|..:|..|:..:::..||.|
Human    90 PIAYDNIKVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQKLMGIVNKVSSSHIGCLVHGCFNAS 154

  Fly   135 IRFTNQSASRE----DIAMDQEIKIRIKNFDISNLMPY-IEGEL---------------LLENG- 178
            |....|.::.:    :|.|..|::..:...|......: |.|:|               :.||| 
Human   155 IPKPEQLSAEQWQTMEINMGDELEFEVFRLDSDAAGVFCIRGKLNITSLQFKRSEVSEEVTENGT 219

  Fly   179 -EAPKNKSIKFGSPPPEEKEVKKEDPDEM-LDALITEIKKEPEFTPRKKTSTKRKNGENG---DT 238
             ||.|.         |::|: ||:||:.. :|:..|::..:.:.||.::::.:..|..||   :.
Human   220 EEAAKK---------PKKKK-KKKDPETYEVDSGTTKLADDADDTPMEESALQNTNNANGIWEEE 274

  Fly   239 TKTKKVKKE 247
            .|.||.||:
Human   275 PKKKKKKKK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13773NP_609081.1 RNAP_I_Rpa43_N 19..107 CDD:239820 28/97 (29%)
POLR1FNP_001002926.1 RNAP_I_Rpa43_N 40..126 CDD:239820 25/90 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..338 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4134
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5219
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55470
OrthoDB 1 1.010 - - D1196232at2759
OrthoFinder 1 1.000 - - FOG0005094
OrthoInspector 1 1.000 - - oto90500
orthoMCL 1 0.900 - - OOG6_103646
Panther 1 1.100 - - LDO PTHR12709
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1174
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.