DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13773 and F10E9.4

DIOPT Version :9

Sequence 1:NP_609081.1 Gene:CG13773 / 33963 FlyBaseID:FBgn0042092 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_498825.1 Gene:F10E9.4 / 184304 WormBaseID:WBGene00017356 Length:262 Species:Caenorhabditis elegans


Alignment Length:179 Identity:42/179 - (23%)
Similarity:83/179 - (46%) Gaps:14/179 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLAMGPYGMANFKHALHEL---LIRTKVGFYDSGLDGIVLGIKNIKVLGQTAGLRADDPTMHLVI 96
            |::: ||.|:. |.|:.|.   :.:..||.|.....|||:.:.::. |.....:.:|....|..:
 Worm    84 HISL-PYHMSG-KAAMEEACDWIAQNTVGKYRKEYKGIVVAVGSVD-LASAPRVISDQYAFHTDV 145

  Fly    97 NADFYVFRPKAGAILSGVVRHISRHHVSAVIYRVFNTSIRFTNQSASREDIAMDQEIKIRIKNFD 161
            ..:..||.||.|......|:::....:..|:..:....|: .|...|.:.:|:|.:|.::.....
 Worm   146 AINQIVFIPKIGDQYEAKVKYVQEGLMVGVVMDMITIHIK-QNDKTSEDQVAIDDKILVKYSGIR 209

  Fly   162 ISNLMPYIEGEL--LLENGEAPKNKSIKFGSPPPEEKEVK---KEDPDE 205
            |.:.:.:::||.  ::|..|..:.:.::  ....||.:||   ||:.||
 Worm   210 IKSSLCHLKGEYVKMIEKAEIKEEEEVE--DEADEETDVKEKVKEEEDE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13773NP_609081.1 RNAP_I_Rpa43_N 19..107 CDD:239820 19/74 (26%)
F10E9.4NP_498825.1 PRK11824 <121..214 CDD:236995 17/94 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103646
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.