DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13773 and polr1f

DIOPT Version :9

Sequence 1:NP_609081.1 Gene:CG13773 / 33963 FlyBaseID:FBgn0042092 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002933336.2 Gene:polr1f / 100145052 XenbaseID:XB-GENE-5812677 Length:471 Species:Xenopus tropicalis


Alignment Length:246 Identity:63/246 - (25%)
Similarity:107/246 - (43%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SVKELENYASSPESCVRCITTDMHLAMGPYGMANFKHALHELLIRTKVGFYDSGLDGIVLGIKNI 76
            |..|......|..||:...|...||.:.|..:...:..:.|.| .|.:..|:.||.|:.:...:|
 Frog    29 SFSEACELVRSRYSCLVVETHRRHLTLSPKFLQKKRSGIQEQL-NTDLLKYNEGLKGVPVAYDSI 92

  Fly    77 KVLGQTAGLRADDPTMHLVINADFYVFRPKAGAILSGVVRHISRHHVSAVIYRVFNTSI----RF 137
            |::|:...:..|...:|:.|.|||.:|.||.|..|.|:|..::..|:..:::..||.||    :.
 Frog    93 KLVGELGDIFDDLGHIHINIEADFVIFNPKCGQTLVGIVNKVAPTHIGCLVHGCFNASIPKPPKM 157

  Fly   138 TNQSASREDIAMDQEIKIRIKNFDISNLMPY-IEGELLLENGEAPKNKSIKFGSPPPEEKEVKKE 201
            ..::..|..:.:|.||:..:...|...:..: |.|:|       .:....|....|.||...:.:
 Frog   158 PIENWQRIGVNIDDEIEFEVFRLDSDAVGVFCIRGKL-------DRRMEDKAYETPCEETAEQAD 215

  Fly   202 D--PDEMLDALITEIKKEPEFTPRKKTSTKRKNGENGDT-TKTKKVKKEIK 249
            |  .|:..|||             :.::.:....||||. .|.||.:|:.|
 Frog   216 DGTSDKDADAL-------------ESSNMESSVQENGDVQEKAKKKRKKQK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13773NP_609081.1 RNAP_I_Rpa43_N 19..107 CDD:239820 25/87 (29%)
polr1fXP_002933336.2 RNAP_I_Rpa43_N 36..123 CDD:239820 25/87 (29%)
RPA43_OB 121..>153 CDD:407731 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1196232at2759
OrthoFinder 1 1.000 - - FOG0005094
OrthoInspector 1 1.000 - - oto104298
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1174
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.